PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G13080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family HD-ZIP
Protein Properties Length: 868aa    MW: 91371 Da    PI: 6.2381
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G13080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21130185156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  LPERR09G13080.1 130 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 185
                      688999***********************************************999 PP

2START170.89e-543445781205
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS...........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                      ela++a++elvk a+ +ep+W  s     + +n+de+ + f++  +          + +ea r+sg+ +  +++lv +l+d + +W+e+++   
  LPERR09G13080.1 344 ELALAAMDELVKVAQMDEPLWLPSLdggfDTLNYDEYHRAFVRVLGqtslaagaagFVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPciv 436
                      5899*************************************8865599***********************************.********** PP

                      .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.......-TTSEE-EESSEEEEEEEE CS
            START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe......sssvvRaellpSgiliepk 157
                       +a+t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSv+    p         s+++ ++llp+g++++++
  LPERR09G13080.1 437 aRASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVNAMLRPGGgdqnggGSPYMGCRLLPTGCIVQDM 530
                      **************************************************************987765455556799***************** PP

                      CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       ng+skvtwv h+++++  +h l+r+l++sg+a ga++w+a lqrqc+
  LPERR09G13080.1 531 NNGYSKVTWVVHAEYDETAVHHLYRPLLRSGQALGARRWLASLQRQCQ 578
                      ***********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.72E-22113187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-23118187IPR009057Homeodomain-like
PROSITE profilePS5007118.301127187IPR001356Homeobox domain
SMARTSM003891.5E-19128191IPR001356Homeobox domain
PfamPF000466.4E-19130185IPR001356Homeobox domain
CDDcd000861.04E-19130187No hitNo description
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084839.869335582IPR002913START domain
SuperFamilySSF559615.91E-28339578No hitNo description
SMARTSM002344.5E-36344579IPR002913START domain
PfamPF018521.8E-45344578IPR002913START domain
CDDcd088751.77E-107350578No hitNo description
SuperFamilySSF559612.61E-14598791No hitNo description
SuperFamilySSF559612.61E-14819850No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 868 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGGGGAGGGM HNTGRLLHTP PLPKPGGGYA APGLSLGLQT  60
NMDGGGGGQL GDMNRSLAMM GNGGSGSGGD GDSLGRGRED ENDSRSGSDN LEGASGDDLD  120
PDNSNPRKKK KRYHRHTPQQ IQELEAVFKE CPHPDEKQRM ELSRRLNLES RQVKFWFQNR  180
RTQMKTQIER HENALLRQEN DKLRAENMTI RDAMRNPMCS SCGGAAVLGE VSLEEQHLRI  240
ENARLKDELD RVCALAGKFL GRPVSAISSS PSPPSLHAAC SGLELGVGCT NGGGGIAGGG  300
FGALQSIPAL MGAAAMRLPA GIGGGLDGSG AGDVGGVDRA VLLELALAAM DELVKVAQMD  360
EPLWLPSLDG GFDTLNYDEY HRAFVRVLGQ TSLAAGAAGF VSEATRESGI AIISSVDLVD  420
SLMDAPRWSE MFPCIVARAS TTDIISSGMG GTRSGSIQLM HAELQVLSPL VPIREVVFLR  480
FCKQHAEGLW AVVDVSVNAM LRPGGGDQNG GGSPYMGCRL LPTGCIVQDM NNGYSKVTWV  540
VHAEYDETAV HHLYRPLLRS GQALGARRWL ASLQRQCQYL AILCSNSLPS RDHAAITPVG  600
RRSMLKLAQR MTDNFCAGVC ASAAQKWRRL DEWRGGENGG GGGEGEDKVR MMARHSVGAP  660
GEPPGVVLSA TTSVRLPGTL PGRVFDYLRD EQRRGDWDIL ANGEAMQEMD HIAKGQHHGN  720
AVSLLRPNAT SGNQNNMLIL QETCTDSSGC LVVYAPVDVQ SMHVVMNGGD SAYVSLLPSG  780
FAILPDGHND GTLPSPADVG SASPNSAAAA NGGGSNNTGS LVTVAFQILV NNLPTAKLTV  840
ESVDTVSNLL SCTIQKIKSA LQASIISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126131RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0718770.0AK071877.1 Oryza sativa Japonica Group cDNA clone:J013040J18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696802.10.0PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ROC6-like
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A0D9XFV40.0A0A0D9XFV4_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g35760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein